Galaxy History ' Unnamed history'


DatasetAnnotation
1: Gene Family results
108 sequences
format: fasta, database: ?
Info: ERROR: Unable to read builds file: [Errno 2] No such file or directory: '/home/galaxy/galaxy-dist/lib/galaxy/util/../../../tool-data/shared/ucsc/publicbuilds.txt'
ERROR: Unable to read builds file: [Errno 2] No such file or directory: '/home/galaxy/galaxy
>MA_30905g0010
MGCHVQILVAGENNNLKAGEESSASLKSEAAAKNGSSLSQPKTKRARKSLPKEKPVDSNAARRSSIYRGVTRHRSTGRYE
AHLWDKSSWNETKHKKGRQVYLGAYNDEETAAHAYDLAALKYWGSETTLNFPSNTYSKELEAMQGISKEEYLASLRRRSS
GFSRGVSKYRGVARHHHNGRWEARIGRVFGNKYLYLGTYNTEEEAAAAYDMAAVEYRGLNAVTNFDLSRYAAYLRPGQNG
FSVEQSEFSSKAPEIEKSCISQGSYQSHHDETCELSDRIPQSASASTALELLFQSAKFKEMLERSKSDSGLIQPEQSKSL
EEKHESISYSDDMMDAFFENSDLLINVEEGQDITQFLESSSCDNADIFHGVEADMEIQISGLGICSSELDLDQQDYDLMH
2: Concatenate datasets on data 1 and data 1
216 sequences
format: fasta, database: ?
>MA_30905g0010
MGCHVQILVAGENNNLKAGEESSASLKSEAAAKNGSSLSQPKTKRARKSLPKEKPVDSNAARRSSIYRGVTRHRSTGRYE
AHLWDKSSWNETKHKKGRQVYLGAYNDEETAAHAYDLAALKYWGSETTLNFPSNTYSKELEAMQGISKEEYLASLRRRSS
GFSRGVSKYRGVARHHHNGRWEARIGRVFGNKYLYLGTYNTEEEAAAAYDMAAVEYRGLNAVTNFDLSRYAAYLRPGQNG
FSVEQSEFSSKAPEIEKSCISQGSYQSHHDETCELSDRIPQSASASTALELLFQSAKFKEMLERSKSDSGLIQPEQSKSL
EEKHESISYSDDMMDAFFENSDLLINVEEGQDITQFLESSSCDNADIFHGVEADMEIQISGLGICSSELDLDQQDYDLMH