Galaxy History ' Cazemes'


DatasetAnnotation
2: CAZEmes.txt
1,417 lines
format: tabular, database: ?
Info: uploaded txt file
1
Potri Ids
Potri.001G001100
Potri.001G007400
Potri.001G011900
Potri.001G012000
Potri.001G012200
3: all_v3_unique_protein.fa
41,335 sequences
format: fasta, database: ?
Info: uploaded fasta file
>Potri.T155100
MAISKLLIVFLVASLLVLRLVEADQKVVNSNIQAASYPPGKNIDCGGACNARCSLSSRPRLCKRACGTCCARCKCVPPGT
SGNHYTCPCYATMTTRGGRLKCP*
>Potri.T155200
MKATRRPIQAVARWVRRQPPKMKAFLAVVSGLAALVFLRMVVRDHDNLFVAAEVVHSIGISVLIYKLMKEKTCAGLSLKS
QELIAIFLAVRLYCSFVMEYDIHTLLDSATLLTTLWVIYTIRFNLRSSYMEGKDNFAIYYLVIPCAVLALYIHPRTHHHI
4: With matched ID
1,415 sequences
format: fasta, database: ?
Info: Using 1417 IDs from tabular file
Generating two FASTA files
>Potri.010G167200
MRARCVLKRKLKWFTPLCRKMALAGIFLVGFLAMVSSVYGYGGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEIRCVNDPKWCLPGSIVITATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQFRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNAAPSS
WSFGQTFSGAQFR*
>Potri.010G247600
MSSLKAYGKLDEAEQARLEARRRTRKRITIISLSSILLVAIVVAAVVGTHASSGNSKKGGADKSLSTSVKAVCDVTLYKDSCYNSLAPVAKPDQLQPEELFKLAIQVAKNELSKASQHFSKDGGVLYNGVKDNMTITALENCQELLSLALDHLDNSLEAGHGVNVIDIVDDLRSWLSTSGTCYQTCIDGLSETKLEATAHDYLKNSSELTSNSLAIITWISKVASSVNIHRRLMNYEDQDMPKWLHPEDRKLLQSS
DLKKKADVVVAKDGSGKYKRISDALKNVPEKSKKRYVIYVKKGIYFENVRVEKKQWNVMMIGDGMKETIVSASLNVVDGTPTFSTATFAVFGKGFIARDMGFRNTAGAIKHQAVALMSNADMSAFYRCSMDAFQDTLYAHANRQFYRECNIYGTVDFIFGNSAVVIQSSSILPRKPMQGQQNTITAQGKIDPNQNTGISIQNCTIWPYGDLSSVKTFLGRPWKNYSTTVFMRSMMGSLIDPAGWLPWTGNTAPPTI
5: Without matched ID
39,920 sequences
format: fasta, database: ?
Info: Using 1417 IDs from tabular file
Generating two FASTA files
>Potri.T155100
MAISKLLIVFLVASLLVLRLVEADQKVVNSNIQAASYPPGKNIDCGGACNARCSLSSRPRLCKRACGTCCARCKCVPPGTSGNHYTCPCYATMTTRGGRLKCP*
>Potri.T155200
MKATRRPIQAVARWVRRQPPKMKAFLAVVSGLAALVFLRMVVRDHDNLFVAAEVVHSIGISVLIYKLMKEKTCAGLSLKSQELIAIFLAVRLYCSFVMEYDIHTLLDSATLLTTLWVIYTIRFNLRSSYMEGKDNFAIYYLVIPCAVLALYIHPRTHHHIVNRICWAFCVYLESISVLPQLRVMQNTKIVEPFTAHYVFALGVARFLGCAHWILQVLDTRGRLLTALGYGMWPLMVLLSEIVQTFILADFCYYYVK
SVLGGQLVLRLPSGVV*
>Potri.010G069000