Published Histories | chanaka | PlantGenIE Phylogeny tree
Import history

Galaxy History ' PlantGenIE Phylogeny tree'


DatasetAnnotation
1: All_ERFs.txt
411 sequences
format: fasta, database: ?
Info: uploaded fasta file
>AT2G20880
MATAKNKGKSIRVLGTSEAEKKDEMELEEEFQFSSGKYKDSGPGSDMWLGDASSTSPRSLRKTRTFDRHNPYLVSSYATP
QPPTTTTCSVSFPFYLPPAIQNQQRFLHPNDPSGQRQQQMISFDPQQQVQPYVAQQQQQQQHLLQYWRDILKLSPSGRMM
MMNMLRQESDLPLTRPPVQPFSATKLYRGVRQRHWGKWVAEIRKPRNRTRLWLGTFDTAEEAAMAYDREAFKLRGETARL
NFPELFLNKQEPTPVHQKQCETGTTSEDSSRRGEDDSSTALAVGGVSEETGWAEAWFNAIPEEWGPGSPLWDDYHFPISN
HKDDLDATQNSSSDTI
2: MUSCLE on data 1: aligned sequences
411 sequences
format: fasta, database: ?
>Potri.010G125600
------------------------------------------------------------
--------------------------------------------------------MSPK
RQSLLYTKTGNKTNDNKRILSQESKMESTMRKIRVICYDPYATESDSSDDESDKKSSRKR
FVREINLPLVVTPQPKAFEPESSCQDSNNSAKSPGKKMR---------------------
----------VLPETPTSTFEAKK------------------------------------
3: MUSCLE on data 1: log
3 lines
format: txt, database: ?
Started Mon Dec 12 13:52:07 2016
muscle -quiet -in /mnt/spruce/public/ftp/database/files/014/dataset_14558.dat -out /mnt/spruce/public/ftp/database/files/014/dataset_14559.dat -log /mnt/spruce/public/ftp/database/files/014/dataset_14560.dat -maxiters 16
Finished Mon Dec 12 13:54:34 2016
4: gblocks on data 2: screen Log
5 lines
format: txt, database: ?
411 sequences and 924 positions in the first alignment file:
/mnt/spruce/public/ftp/database/files/014/dataset_14559.dat
/mnt/spruce/public/ftp/database/files/014/dataset_14559.dat
Original alignment: 924 positions
5: gblocks on data 2: html File
714.7 KB
format: html, database: ?
HTML file
6: gblocks on data 2: Output File
822 lines
format: txt, database: ?
>Potri.010G125600
WLGTFDTLEE AAQAY
>Potri.008G120100
WLGTFNTLEE AAQAY
>AT1G25470
WLGTYETPAE AEKAY
7: Remove gaps
411 sequences
format: fasta, database: ?
>Potri.010G125600
WLGTFDTLEEAAQAY
>Potri.008G120100
WLGTFNTLEEAAQAY
>AT1G25470
WLGTYETPAEAEKAY
8: Remove gaps.phy
412 lines
format: phy, database: ?
411 15
Potri.010G125600 WLGTFDTLEEAAQAY
Potri.008G120100 WLGTFNTLEEAAQAY
AT1G25470 WLGTYETPAEAEKAY
AT1G68550 WLGTFDTLEEAAKAY
AT3G25890 WLGTYETLEQAADAY
9: Newick Tree
1 line
format: nhx, database: ?
Info:





..........................
ooooooooooooooooooooooooooooo CURRENT SETTINGS ooooooooooooooooooooooooooooooooooo
....................
(Potri.003G054100:0.00000001,(AT1G33760:0.08672999,((Potri.013G101200:0.04174133,Potri.019G075600:0.05223452)0.770000:0.08010663,((Potri.001G181500:0.00000001,Potri.019G075500:0.00000001)0.000000:0.00000205,((AT1G71450:0.00000001,Potri.013G101100:0.0000000
1)0.000000:0.04495485,(MA_32651g0010:0.09293151,(MA_66742g0010:0.00000339,((Potri.002G172600:0.00000001,(Potri.002G172200:0.00000001,(Potri.002G172300:0.00000001,(AT1G01250:0.00000001,Potri.014G099900:0.00000001)0.000000:0.00000001)0.000000:0.00000001)0.00
0000:0.00000001)0.894000:0.21904426,(((Potri.001G110500:0.00000001,Potri.003G121200:0.00000001)0.846000:0.10770786,((AT2G36450:0.19791078,(Potri.016G018600:0.00000001,Potri.006G021000:0.00000001)0.769000:0.12398997)0.764000:0.10215526,((AT5G52020:0.0218101
8,AT1G12630:0.20641825)0.755000:0.09017984,(Potri.012G134000:0.00000001,Potri.015G136300:0.10812506)0.000000:0.00000458)0.839000:0.10265376)0.000000:0.00001000)0.770000:0.12870304,((Potri.012G134100:0.00000001,(((Potri.015G136400:0.00000236,AT3G16280:0.115
21515)0.837000:0.09776380,(AT2G25820:0.00000001,(AT4G32800:0.09681772,AT5G51990:0.09781908)0.000000:0.00000240)0.000000:0.00000385)0.000000:0.00000265,(Potri.006G238600:0.10910284,((Potri.003G050700:0.00000001,(Potri.001G155700:0.00000001,(Potri.001G187500
:0.00000001,(Potri.018G043900:0.00000001,(AT5G11590:0.00000001,(MA_896002g0010:0.00000001,(MA_67841g0010:0.00000001,((AT5G25810:0.00000433,(Potri.004G187000:0.04041502,(MA_15251g0010:0.18771194,Potri.009G147700:0.13405354)0.688000:0.06262822)0.785000:0.089
10: Phyml statistics output
33 lines
format: txt, database: ?
Info:





..........................
ooooooooooooooooooooooooooooo CURRENT SETTINGS ooooooooooooooooooooooooooooooooooo
....................
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
--- PhyML 20120412 ---
http://www.atgc-montpellier.fr/phyml
Copyright CNRS - Universite Montpellier II
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo