Published Histories | chanaka | Phylogeny workflow test
Import history

Galaxy History ' Phylogeny workflow test'


DatasetAnnotation
12: Gene Family results
106 sequences
format: fasta, database: ?
Info: ERROR: Unable to read builds file: [Errno 2] No such file or directory: '/home/galaxy/galaxy-dist/lib/galaxy/util/../../../tool-data/shared/ucsc/publicbuilds.txt'
ERROR: Unable to read builds file: [Errno 2] No such file or directory: '/home/galaxy/galaxy
>MA_7341067g0010
CYYGGEDKGKSGLGKSVSYGKHFLKHIMTRSIDIGKCPLTLEEVGLMLQALGFGNDSYRYVASGEVYGGEHIASQLNIIK
AIKEARTIKRFFPSEFGNNVDNVHVVEPTKSIFEMKAKVPQAGLMAPPRDKVVILGDGNAKAVYAKVENVGTFEIKAVDD
PRTLDKTLYLILHANTLSFNELVALWKKNIGKTLEKVYVSEEQVVKLIVETPFPTNIVIEISHSIFMKGDQTNFEIGHDG
VEGSQLYLDVKYTTVKLRLLRK
>MA_10427517g0010
13: MUSCLE on data 12: aligned sequences
106 sequences
format: fasta, database: ?
Info: MUSCLE v3.8.31 by Robert C. Edgar
>MA_430645g0010
------------------------------------------------------------
------------------------------------------------------------
-----------------RQRKRKWPDAGGLAERSADIDGGRL------------------
----------------MGMLHGSMDGQ---------------------------------
------------------------------------------------------------
14: MUSCLE on data 12: log
3 lines
format: txt, database: ?
Info: MUSCLE v3.8.31 by Robert C. Edgar
Started Mon Feb 23 21:01:04 2015
muscle -quiet -in /mnt/spruce/public/ftp/database/files/011/dataset_11490.dat -out /mnt/spruce/public/ftp/database/files/011/dataset_11495.dat -log /mnt/spruce/public/ftp/database/files/011/dataset_11496.dat -maxiters 16
Finished Mon Feb 23 21:01:17 2015
15: gblocks on data 13: screen Log
5 lines
format: txt, database: ?
106 sequences and 856 positions in the first alignment file:
/mnt/spruce/public/ftp/database/files/011/dataset_11495.dat
/mnt/spruce/public/ftp/database/files/011/dataset_11495.dat
Original alignment: 856 positions
16: gblocks on data 13: html File
121.7 KB
format: html, database: ?
HTML file
17: gblocks on data 13: Output File
106 lines
format: txt, database: ?
>MA_430645g0010
>MA_129275g0010
>MA_56976g0010
18: Remove gaps
106 sequences
format: fasta, database: ?
>MA_430645g0010
>MA_129275g0010
>MA_56976g0010
19: Remove gaps.phy
107 lines
format: phy, database: ?
106 0
MA_430645g0010
MA_129275g0010
MA_56976g0010
MA_320221g0010
MA_9922789g0010
20: Newick Tree
empty
format: nhx, database: ?
Info:

. The sequence length cannot be negative.

. Type enter to exit.
21: Phyml statistics output
empty
format: txt, database: ?
Info:

. The sequence length cannot be negative.

. Type enter to exit.